PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009125422.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 310aa    MW: 36976.6 Da    PI: 6.8143
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009125422.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix73.73.1e-2345127186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +e+++L+ +r+e+++++ ++k++k lWe v +km+++gf rs++qCk+kw+nl  ryk ++++e +   + ++++p++++++
  XP_009125422.1  45 QWSIDETKELLGIREELDQTFMETKRNKLLWEVVVAKMADKGFARSAEQCKSKWKNLVSRYKVCETTEPE---PIRQQFPFYNEIQ 127
                     7********************************************************************8...566789***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.71E-2044106No hitNo description
PfamPF138378.5E-2045129No hitNo description
PROSITE profilePS500907.44546102IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDRRNPFHHH DHQLYQLIQQ QQLPPPPQST TVAMDLGGGG ERIPQWSIDE TKELLGIREE  60
LDQTFMETKR NKLLWEVVVA KMADKGFARS AEQCKSKWKN LVSRYKVCET TEPEPIRQQF  120
PFYNEIQSIF TARMQRMLWS EPRTSSKRKH NQFSSDEEVE EVAELNQDIN KELLSFVETQ  180
KKDTEVITTS TFTNPKKRAK KGKGTSKAET AGSTLKEMLE DFMRQTVKME KEWRDAWEMK  240
AREKEKREKE WQRRMAELEE ERAAAERRWM EREDERRLRE EARAQKRDTL IDVLLNQLNR  300
DQDDDQHQGF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2409350.0AC240935.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrF042C17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125422.10.0PREDICTED: trihelix transcription factor GT-3a-like
SwissprotQ9SDW01e-138TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A078EUC50.0A0A078EUC5_BRANA; BnaAnng00230D protein
STRINGBra028899.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-104Trihelix family protein